PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_42500_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 101aa    MW: 11403.4 Da    PI: 8.9953
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_42500_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.88.1e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrng+lKKA+ELSvLCd+evaviifs++g+ ye++s
  Neem_42500_f_1  9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDVEVAVIIFSQKGRRYEFAS 59
                    79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.427161IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-29363IPR002100Transcription factor, MADS-box
CDDcd002656.73E-38362No hitNo description
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MVRGKIQMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD VEVAVIIFSQ KGRRYEFASS  60
ECFSASFLFS PLLVVFLKDI MTSDDQLCCL NALASTISEP L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-18161161Myocyte-specific enhancer factor 2B
1tqe_Q4e-18161161Myocyte-specific enhancer factor 2B
1tqe_R4e-18161161Myocyte-specific enhancer factor 2B
1tqe_S4e-18161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010662343.13e-33PREDICTED: MADS-box protein SOC1-like
RefseqXP_002263450.13e-33PREDICTED: MADS-box protein SOC1-like
RefseqXP_010662342.13e-33PREDICTED: MADS-box protein SOC1-like
RefseqXP_010662341.13e-33PREDICTED: MADS-box protein SOC1-like
RefseqXP_010662339.13e-33PREDICTED: MADS-box protein SOC1-like
RefseqXP_010662338.13e-33PREDICTED: MADS-box protein SOC1-like
RefseqXP_010662337.13e-33PREDICTED: MADS-box protein SOC1-like
SwissprotQ9FIS12e-31AGL42_ARATH; MADS-box protein AGL42
TrEMBLF6HAQ13e-33F6HAQ1_VITVI; Putative uncharacterized protein
STRINGVIT_16s0022g02400.t017e-33(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.42e-29AGAMOUS-like 42